Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Reticulon-4 receptor  

UniProtKB / Swiss-Prot ID :  RTN4R_MACFA

Gene Name (Synonyms) : 
RTN4R, NOGOR QccE-10286  

Species :  Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor (By similarity). 

Protein Function :  Receptor for RTN4, OMG and MAG. Mediates axonal growth inhibition and may play a role in regulating axonal regeneration and plasticity in the adult central nervous system. Acts in conjunction with RTN4 and LIGO1 in regulating neuronal precursor cell motility during cortical development (By similarity). 

Protein Sequence MKRASAGGSRLLAWVLWLQAWRVAAPCPGACVCYNEPKVTTSCPQQGLQAVPAGIPASSQRIFLHGNRIS...
Predicted Secondary Structure CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCEEEECCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures