Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Protein S100-A4  

UniProtKB / Swiss-Prot ID :  S10A4_BOVIN

Gene Name (Synonyms) : 
S100A4, CAPL  

Species :  Bos taurus (Bovine). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAYPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDETAFQKLMSNLDCNKDNEV...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAYPLE
---CCCHHH
18.04UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Purification and primary structure of Capl, an S-100-related calcium-binding protein isolated from bovine retina.";
Polans A.S., Palczewski K., Asson-Batres M.A., Ohguro H., Witowska D.,Haley T.L., Baizer L., Crabb J.W.;
J. Biol. Chem. 269:6233-6240(1994).
Cited for: PROTEIN SEQUENCE OF 2-101.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures