Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Protein S100-A6  

UniProtKB / Swiss-Prot ID :  S10A6_HUMAN

Gene Name (Synonyms) : 
S100A6, CACY  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus envelope. Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. 

Protein Function :  May function as calcium sensor and contribute to cellular calcium signaling (Potential). May function by interacting with other proteins and indirectly play a role in the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative. 

Protein Sequence MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNF...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCEECH...
Protein Variant
LocationDescription
27H -> R (in dbSNP:rs11974). VAR_011982
69N -> S (in dbSNP:rs1802581). VAR_011983
83I -> T (in dbSNP:rs1802582). VAR_011984
90G -> D (in dbSNP:rs2228293). VAR_029281
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
31Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HTLSKKELK
CCCCHHHHH
54.07Phosphositeplus
Link
35Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KKELKELIQ
HHHHHHHHH
52.12Phosphositeplus
Link
40Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ELIQKELTI
HHHHHHHHC
47.93Phosphositeplus
Link
40N6-acetyllysineELIQKELTI
HHHHHHHHC
47.93HPRD
Link
40N6-acetyllysineELIQKELTI
HHHHHHHHC
47.93Phosphositeplus
Link
40N6-acetyllysine.ELIQKELTI
HHHHHHHHC
47.93UniProtKB
Link
47Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TIGSKLQDA
HCCCCCCHH
44.98Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
1433Z_HUMANphysical interactionMINT-3319728MINT15161933
S10A6_HUMANphysical interactionEBI-945542
intact10913138
S10A6_HUMANin vitroHPRD:00237HPRD11937060
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-40, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures