Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Protein S100-A9  

UniProtKB / Swiss-Prot ID :  S10A9_MOUSE

Gene Name (Synonyms) : 
S100a9, Cagb, Mrp14  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Secreted (By similarity). Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein (By similarity). Note=Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood 

Protein Function :  Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Promotes tubulin polymerization when unphosphorylated. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro- inflammatory mediator in acute and chronic inflammation and up- regulates the release of IL8 and cell-surface expression of ICAM1 (By similarity). Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and pro-apoptotic activity is inhibited by zinc ions (By similarity). Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS). 

Protein Sequence MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTN...
Predicted Secondary Structure CCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MANKAP
---CCCCCC
26.65UniProtKB
Link-
107MethylhistidineHGHSHGKGC
CCCCCCCCC
35.99Phosphositeplus
Link-
107Pros-methylhistidine.HGHSHGKGC
CCCCCCCCC
35.99UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Isolation of the murine S100 protein MRP14 (14 kDa migration-inhibitory-factor-related protein) from activated spleen cells:characterization of post-translational modifications and zincbinding.";
Raftery M.J., Harrison C.A., Alewood P.F., Jones A., Geczy C.L.;
Biochem. J. 316:285-293(1996).
Cited for: PROTEIN SEQUENCE OF 2-10; 76-93 AND 95-109, AND MASS SPECTROMETRY.
Methylation
ReferencePubMed
"Isolation of the murine S100 protein MRP14 (14 kDa migration-inhibitory-factor-related protein) from activated spleen cells:characterization of post-translational modifications and zincbinding.";
Raftery M.J., Harrison C.A., Alewood P.F., Jones A., Geczy C.L.;
Biochem. J. 316:285-293(1996).
Cited for: PROTEIN SEQUENCE OF 2-10; 76-93 AND 95-109, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures