Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Selenium-binding protein 1  

UniProtKB / Swiss-Prot ID :  SBP1_HUMAN

Gene Name (Synonyms) : 
SELENBP1, SBP  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus. Cytoplasm, cytosol. Membrane; Peripheral membrane protein (By similarity). Note=May associate with Golgi membrane. May associate with the membrane of autophagosomes (By similarity). 

Protein Function :  Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytoplasm. May be involved in intra-Golgi protein transport (By similarity). 

Protein Sequence MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYCQVIHRLPMPNLKD...
Predicted Secondary Structure CCCCCCCCCCCCCCHHHHHCCCCEEEEEEEEEECCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
201PhosphoserineNVMISTEWA
CEEEEECCC
11.37HPRD
Link-
422PhosphoserineIREGSVMLQ
HHCCCEEEE
10.29HPRD
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
RFA1_HUMANphysical interactionMINT-65165MINT16169070
TRP13_HUMANphysical interactionMINT-67188MINT16189514
MED31_HUMANphysical interactionMINT-65168MINT16169070
RFA1_HUMANphysical interactionEBI-729270
intact16169070
PDIP2_HUMANphysical interactionEBI-733280
intact16169070
MED31_HUMANphysical interactionEBI-728642
intact16169070
RIF1_HUMANphysical interactionEBI-728645
intact16169070
TRP13_HUMANphysical interactionEBI-756244
intact16189514
TRP13_HUMANyeast 2-hybridHPRD:05007HPRD16189514
MED31_HUMANyeast 2-hybridHPRD:05007HPRD16169070
CA103_HUMANyeast 2-hybridHPRD:05007HPRD16169070
PDIP2_HUMANyeast 2-hybridHPRD:05007HPRD16169070
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures