Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fatty acid-binding protein  

UniProtKB / Swiss-Prot ID :  SCP2_YARLI

Gene Name (Synonyms) : 
SCP2 YALI0E01298g  

Species :  Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candidalipolytica). 

Subcellular Localization :  Peroxisome (Potential). 

Protein Function :  May play a role in the transport of fatty acids. Binds fatty acids and fatty acyl-CoAs including palmitic acid, oleic acid, cis-parinaric acid and palmitoyl-CoA (in vitro). 

Protein Sequence MSLKVDGFTSSIIFDVIRDGLNDPSQAKQKAESIKKANAIIVFNLKNKAGKTESWYLDLKNDGDVGKGNK...
Predicted Secondary Structure CCCCCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEEEEEECCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylserine.---MSLKVD
---CCCCCC
36.58UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"A yeast sterol carrier protein with fatty-acid and fatty-acyl-CoAbinding activity.";
Ferreyra R.G., Burgardt N.I., Milikowski D., Melen G.,Kornblihtt A.R., Dell' Angelica E.C., Santome J.A., Ermacora M.R.;
Arch. Biochem. Biophys. 453:197-206(2006).
Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF N-TERMINUS, CLEAVAGEOF INITIATOR METHIONINE, FUNCTION, SUBUNIT, AND ACETYLATION AT SER-2.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures