Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Sarcoplasmic calcium-binding protein, alpha-B and -A chains  

UniProtKB / Swiss-Prot ID :  SCPA_PENSP

Gene Name (Synonyms) :  -
 

Species :  Penaeus sp. (Penoeid shrimp). 

Subcellular Localization :   

Protein Function :  Like parvalbumins, SCP's seem to be more abundant in fast contracting muscles, but no functional relationship can be established from this distribution. 

Protein Sequence AYSWDNRVKYVVRYMYDIDDDGFLDKNDFECLAVRNTLIEGRGEFSAADYANNQKIMRNLWNEIAELADF...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHCCCCCCEEHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC...
Protein Variant
LocationDescription
4Missing (in alpha-A).
61Missing (in alpha-A).
95S -> G (in alpha-A).
107N -> D (in alpha A).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylalanine.----AYSWD
----CCCHH
20.55UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Amino acid sequence of alpha chain of sarcoplasmic calcium bindingprotein obtained from shrimp tail muscle.";
Takagi T., Konishi K.;
J. Biochem. 95:1603-1615(1984).
Cited for: PROTEIN SEQUENCE.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures