Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Secernin-1  

UniProtKB / Swiss-Prot ID :  SCRN1_HUMAN

Gene Name (Synonyms) : 
SCRN1, KIAA0193  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm (By similarity). 

Protein Function :  Regulates exocytosis in mast cells. Increases both the extent of secretion and the sensitivity of mast cells to stimulation with calcium (By similarity). 

Protein Sequence MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVECTYISIDQVPRTYAIMI...
Predicted Secondary Structure CCCCCCCCEEEECCCCCCCCEEEEECCCCCCCCCCCEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEE...
Protein Variant
LocationDescription
189S -> N (in dbSNP:rs35960711). VAR_057709
338Q -> R (in dbSNP:rs17324153). VAR_029512
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
179Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WAAEKVTEG
HHHHHHHHH
50.13Phosphositeplus
Link-
306Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RSIFKPFIF
CCCCCCEEE
37.03Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures