Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  L-serine dehydratase/L-threonine deaminase  

UniProtKB / Swiss-Prot ID :  SDHL_HUMAN

Gene Name (Synonyms) : 
SDS, SDH  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :   

Protein Sequence MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGM...
Predicted Secondary Structure CCCCCCCCCCCCCEEHHHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
41N6-(pyridoxal phosphate)lysine.SGSFKIRGI
CCHHHHHHH
32.94UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
SYSM_HUMANENSP00000257549STRING
SYSC_HUMANENSP00000257549STRING
SYSC_HUMANENSP00000257549STRING
SERB_HUMANENSP00000257549STRING
SPYA_HUMANENSP00000257549STRING
GLYC_HUMANENSP00000257549STRING
GLYM_HUMANENSP00000257549STRING
CBS_HUMANENSP00000257549STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00133L-Serine
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures