Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  L-serine dehydratase/L-threonine deaminase  

UniProtKB / Swiss-Prot ID :  SDHL_RAT

Gene Name (Synonyms) : 
Sds  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Cytoplasm. 

Protein Function :   

Protein Sequence MAAQESLHVKTPLRDSMALSKVAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCKHFVCSSVVQIWG...
Predicted Secondary Structure CCCCCCCCCCCCCHHHHHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAQES
---CCCCCC
20.18UniProtKB
Link-
41N6-(pyridoxal phosphate)lysine.SGSFKIRGI
CCHHHHHHH
32.94UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"The peptide sequences near the bound pyridoxal phosphate areconserved in serine dehydratase from rat liver, and threoninedehydratases from yeast and Escherichia coli.";
Ogawa H., Konishi K., Fujioka M.;
Biochim. Biophys. Acta 996:139-141(1989).
Cited for: PROTEIN SEQUENCE OF 2-5 AND 31-50.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures