Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Serine dehydratase-like  

UniProtKB / Swiss-Prot ID :  SDSL_HUMAN

Gene Name (Synonyms) : 
SDSL  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Has low serine dehydratase and threonine dehydratase activity. 

Protein Sequence MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIRGIGHFCQEMAKKGCRHLVCS...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCEECHHHHHHHCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
48N6-(pyridoxal phosphate)lysine.SGSFKIRGI
CHHHHHHHH
32.94UniProtKB
Link
227Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TSVAKSLGA
CEEEEECCC
44.02Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
SDSL_HUMANphysical interactionMINT-66506MINT16189514
GCP4_HUMANphysical interactionMINT-66914MINT16189514
SDSL_HUMANphysical interactionEBI-754006
intact16189514
SDSL_HUMANyeast 2-hybridHPRD:11542HPRD16189514
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures