Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  D-3-phosphoglycerate dehydrogenase  

UniProtKB / Swiss-Prot ID :  SERA_HUMAN

Gene Name (Synonyms) : 
PHGDH, PGDH3  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKL...
Predicted Secondary Structure CCCCCCCEEEEECCCCHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCCEEEECCCCCCCHHHHHCCCCC...
Protein Variant
LocationDescription
135R -> W (in PHGDH deficiency; results in a2-fold decrease in enzyme activity with
261V -> M (in PHGDH deficiency; results in afour-fold decrease in substrate affinity
373A -> T (in PHGDH deficiency; results inalmost undetectable enzyme activity with
377G -> S (in PHGDH deficiency; results in a2-fold decrease in enzyme activity with
425V -> M (in PHGDH deficiency; results inalmost undetectable enzyme activity with
490V -> M (in PHGDH deficiency; results inalmost undetectable enzyme activity with
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAFANL
---CCCCCC
16.56UniProtKB
Link-
21Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PCCRKILQD
HHHHHHHHC
33.58Phosphositeplus
Link
33Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QVVEKQNLS
EEEECCCCC
32.64Phosphositeplus
Link
58Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RSATKVTAD
CCCCCCCHH
36.99Phosphositeplus
Link
69Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NAAEKLQVV
HCCCCCEEE
39.22Phosphositeplus
Link
78PhosphothreonineGRAGTGVDN
EEECCCCCC
32.80HPRD
Link
78PhosphothreonineGRAGTGVDN
EEECCCCCC
32.80Phosphositeplus
Link
89PhosphothreonineLEAATRKGI
HHHHHHCCC
39.71HPRD
Link
125PhosphothreonineIPQATASMK
CHHHHHHHH
17.64Phosphositeplus
Link
127PhosphoserineQATASMKDG
HHHHHHHHC
23.24Phosphositeplus
Link
129Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TASMKDGKW
HHHHHHCCC
61.91Phosphositeplus
Link
146Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ELNGKTLGI
CCCCCEEEE
39.23Phosphositeplus
Link
281S-nitrosocysteineNVISCPHLG
CEEECCCCC
1.37dbSNO
Link
281S-nitrosocysteineNVISCPHLG
CEEECCCCC
1.37HPRD
Link
289Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GASTKEAQS
CCCCHHHHH
48.86Phosphositeplus
Link
326PhosphoserineTSAFSPHTK
CHHHCHHHH
18.58HPRD
Link-
351Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AGSPKGTIQ
CCCCCCEEE
71.08Phosphositeplus
Link-
364Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GTSLKNAGN
CCHHHCCCC
44.51Phosphositeplus
Link-
369S-nitrosocysteineNAGNCLSPA
CCCCHHHHH
3.78dbSNO
Link-
369S-nitrosocysteineNAGNCLSPA
CCCCHHHHH
3.78HPRD
Link-
371PhosphoserineGNCLSPAVI
CCHHHHHHH
17.02HPRD
Link-
371PhosphoserineGNCLSPAVI
CCHHHHHHH
17.02PhosphoELM
Link-
371PhosphoserineGNCLSPAVI
CCHHHHHHH
17.02Phosphositeplus
Link-
371PhosphoserineGNCLSPAVI
CCHHHHHHH
17.02SysPTM
Link-
371Phosphoserine.GNCLSPAVI
CCHHHHHHH
17.02UniProtKB
Link-
380Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VGLLKEASK
HHHHHHHHC
57.17Phosphositeplus
Link-
384Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KEASKQADV
HHHHCCCCC
57.46Phosphositeplus
Link-
394Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LVNAKLLVK
EEECCHHHH
36.83Phosphositeplus
Link-
480PhosphothreonineAMLPTMIGL
CCHHHHHHH
19.91HPRD
Link-
480PhosphothreonineAMLPTMIGL
CCHHHHHHH
19.91Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
TNR1B_HUMANphysical interactionMINT-49387MINT14743216
M3K3_HUMANphysical interactionMINT-48403MINT14743216
- top -

Disease Reference
Kegg disease
OMIM disease
601815Phosphoglycerate dehydrogenase deficiency (PHGDHD)
256520Neu-Laxova syndrome 1 (NLS1)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-371, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures