Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Phosphoserine aminotransferase  

UniProtKB / Swiss-Prot ID :  SERC_HUMAN

Gene Name (Synonyms) : 
PSAT1, PSA  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Catalyzes the reversible conversion of 3- phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4- phosphonooxybutanoate to phosphohydroxythreonine (By similarity). 

Protein Sequence MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNY...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCC...
Protein Variant
LocationDescription
87P -> A (in dbSNP:rs11540974). VAR_048235
100D -> A (in PSATD; reduced Vmax). VAR_037252
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylmethionine.----MDAPR
----CCCCC
10.01UniProtKB
Link-
16Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PGPAKLPHS
CCCCCCCHH
66.73Phosphositeplus
Link
27Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LEIQKELLD
HHHHHHHHC
56.86Phosphositeplus
Link
51Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SDFAKIINN
HHHHHHHHH
44.08Phosphositeplus
Link
51N6-acetyllysineSDFAKIINN
HHHHHHHHH
44.08HPRD
Link
51N6-acetyllysineSDFAKIINN
HHHHHHHHH
44.08Phosphositeplus
Link
51N6-acetyllysine.SDFAKIINN
HHHHHHHHH
44.08UniProtKB
Link
94Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LIGLKAGRC
HHCCCCCCE
43.51Phosphositeplus
Link
127N6-acetyllysineIVHPKLGSY
EEEECCCCC
51.07HPRD
Link
178PhosphoserineVCDMSSNFL
EEEECHHHC
14.63HPRD
Link
179PhosphoserineCDMSSNFLS
EEECHHHCC
25.59HPRD
Link
190Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VDVSKFGVI
CCHHHCCEE
46.08Phosphositeplus
Link
269Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AAMEKLSSI
HHHHHHHHH
40.35Phosphositeplus
Link
269N6-acetyllysineAAMEKLSSI
HHHHHHHHH
40.35HPRD
Link
269N6-acetyllysineAAMEKLSSI
HHHHHHHHH
40.35Phosphositeplus
Link
269N6-acetyllysine.AAMEKLSSI
HHHHHHHHH
40.35UniProtKB
Link
311Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IGNAKGDDA
ECCCCCHHH
67.86Phosphositeplus
Link
318Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DALEKRFLD
HHHHHHHHH
49.66Phosphositeplus
Link
318N6-acetyllysineDALEKRFLD
HHHHHHHHH
49.66HPRD
Link
318N6-acetyllysineDALEKRFLD
HHHHHHHHH
49.66Phosphositeplus
Link
318N6-acetyllysine.DALEKRFLD
HHHHHHHHH
49.66UniProtKB
Link
323Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RFLDKALEL
HHHHHHHHC
57.95Phosphositeplus
Link
323N6-acetyllysineRFLDKALEL
HHHHHHHHC
57.95HPRD
Link
323N6-acetyllysineRFLDKALEL
HHHHHHHHC
57.95Phosphositeplus
Link
323N6-acetyllysine.RFLDKALEL
HHHHHHHHC
57.95UniProtKB
Link
331PhosphoserineLNMLSLKGH
CCHHHCCCC
19.78HPRD
Link
331PhosphoserineLNMLSLKGH
CCHHHCCCC
19.78Phosphositeplus
Link
333Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MLSLKGHRS
HHHCCCCCC
49.66Phosphositeplus
Link
333N6-acetyllysineMLSLKGHRS
HHHCCCCCC
49.66HPRD
Link
333N6-acetyllysineMLSLKGHRS
HHHCCCCCC
49.66Phosphositeplus
Link
333N6-acetyllysine.MLSLKGHRS
HHHCCCCCC
49.66UniProtKB
Link
344PhosphoserineGIRASLYNA
EEEEEEECC
22.87HPRD
Link
344PhosphoserineGIRASLYNA
EEEEEEECC
22.87Phosphositeplus
Link
346PhosphotyrosineRASLYNAVT
EEEEECCCC
9.89HPRD
Link
346PhosphotyrosineRASLYNAVT
EEEEECCCC
9.89SysPTM
Link
363Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AFMKKFLEM
HHHHHHHHH
43.31Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
HS90B_HUMANphysical interactionMINT-72656MINT16263121
- top -

Disease Reference
Kegg disease
OMIM disease
610992Phosphoserine aminotransferase deficiency (PSATD)
616038Neu-Laxova syndrome 2 (NLS2)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-51; LYS-269; LYS-318;LYS-323 AND LYS-333, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures