Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Beta-galactoside alpha-2,6-sialyltransferase 1  

UniProtKB / Swiss-Prot ID :  SIAT1_HUMAN

Gene Name (Synonyms) : 
ST6GAL1, SIAT1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane- bound form in trans cisternae of Golgi. Secreted into the body fluid. 

Protein Function :  Transfers sialic acid from the donor of substrate CMP- sialic acid to galactose containing acceptor substrates. 

Transmembrane Topology (topPTM) : SIAT1_HUMAN 

Protein Sequence MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQD...
Predicted Secondary Structure CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCEECHHHHHHHHCCCCHHHHHHCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
149N-linked (GlcNAc...).RDHVNVSMV
CCEEEEEEC
19.41UniProtKB
Link
161N-linked (GlcNAc...).DFPFNTSEW
CCCCCCCCC
42.82UniProtKB
Link
194Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AGSLKSSQL
CCEECCCCC
50.16Phosphositeplus
Link
226Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DVGTKTTIR
HCCCCCEEE
37.43Phosphositeplus
Link
241Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VTTEKRFLK
CCCCCCCCC
46.49Phosphositeplus
Link
369PhosphotyrosineTMGAYHPLL
CCCCCCCCH
9.76Phosphositeplus
Link
369Phosphotyrosine.TMGAYHPLL
CCCCCCCCH
9.76UniProtKB
Link
391PhosphotyrosineDEDIYLLGK
EEEEEEECC
14.27HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CD22_HUMANin vitroHPRD:00184HPRD8702538
SIAT1_HUMANin vivoHPRD:00184HPRD11356854
CD22_HUMANENSP00000169298STRING
B4GT3_HUMANENSP00000169298STRING
B4GT2_HUMANENSP00000169298STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-149 AND ASN-161, AND MASSSPECTROMETRY.
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-369, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures