Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  DNA-binding protein SMUBP-2  

UniProtKB / Swiss-Prot ID :  SMBP2_MESAU

Gene Name (Synonyms) : 
IGHMBP2, RIP1, SMUBP2  

Species :  Mesocricetus auratus (Golden hamster). 

Subcellular Localization :  Nucleus. Cytoplasm. Cell projection, axon (By similarity). Note=Colocalizes with the traslation initiation factor EIF4G2 (By similarity). 

Protein Function :  5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Acts as a transcription regulator. Required for the transcriptional activation of the flounder liver- type antifreeze protein gene. Exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron (By similarity). May be involved in translation. DNA- binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region. Preferentially binds to the 5'-GGGCT-3' motif. Interacts with tRNA-Tyr (By similarity). Binds to the insulin II gene RIPE3B enhancer region. 

Protein Sequence MALSTVESFVAQQLELLELERDAEVEERRSWQEHSSLKELQSRGVCLLKLQVSSQCTGLYGQRLVTFEPR...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCEEEEEEEEEEEEEEEEEECC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures