Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  SET and MYND domain-containing protein 3  

UniProtKB / Swiss-Prot ID :  SMYD3_HUMAN

Gene Name (Synonyms) : 
SMYD3, ZMYND1, ZNFN3A1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Nucleus. Note=Mainly cytoplasmic when cells are arrested at G0/G1. Accumulates in the nucleus at S phase and G2/M. 

Protein Function :  Histone methyltransferase. Specifically methylates 'Lys- 4' of histone H3, inducing di- and tri-methylation, but not monomethylation. Plays an important role in transcriptional activation as a member of an RNA polymerase complex. Binds DNA containing 5'-CCCTCC-3' or 5'-GAGGGG-3' sequences. 

Protein Sequence MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKY...
Predicted Secondary Structure CCCCEEEEEECCCCCCEEEEECCCCCCCEEECCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
122Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SESEKLYSF
CCCHHHHHH
63.10Phosphositeplus
Link
124PhosphotyrosineSEKLYSFYD
CHHHHHHHH
14.06Phosphositeplus
Link
239PhosphotyrosineLTICYLDML
EEEEECHHH
11.24Phosphositeplus
Link
378Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MKVGKLQLH
HHHHHHHHH
35.73Phosphositeplus
Link
391Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PQAMKNLRL
HHHHHHHHH
56.71Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PBX2_HUMANphysical interactionMINT-62527MINT14667819
FACR1_HUMANphysical interactionEBI-1070336
intact17353931
OST48_HUMANphysical interactionEBI-1064178
intact17353931
HS90A_HUMANin vitro
in vivo
HPRD:12297HPRD15235609
PBX2_HUMANyeast 2-hybridHPRD:12297HPRD14667819
HELZ_HUMANin vitro
in vivo
HPRD:12297HPRD15235609
RPAB4_HUMANin vitro
in vivo
HPRD:12297HPRD15235609
HS90A_HUMANENSP00000331557STRING
HS90A_HUMANENSP00000331557STRING
HS90A_HUMANENSP00000331557STRING
HELZ_HUMANENSP00000331557STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures