Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  SNW domain-containing protein 1  

UniProtKB / Swiss-Prot ID :  SNW1_MOUSE

Gene Name (Synonyms) : 
Snw1, Skiip  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Nucleus (By similarity). 

Protein Function :  Involved in vitamin D-mediated transcription. Can function as a splicing factor in pre-mRNA splicing (By similarity). 

Protein Sequence MALTSFLPAPTQLSQDQLEAEERARSQRSLQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVA...
Predicted Secondary Structure CCCHHHCCCCCCCCHHHHHHHHHHHCCCCCCCCHHCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
224PhosphoserineRGPPSPPAP
CCCCCCCCC
46.80PhosphoELM
Link-
224PhosphoserineRGPPSPPAP
CCCCCCCCC
46.80Phosphositeplus
Link-
224PhosphoserineRGPPSPPAP
CCCCCCCCC
46.80SysPTM
Link-
224Phosphoserine.RGPPSPPAP
CCCCCCCCC
46.80UniProtKB
Link-
230Methionine sulfonePAPVMHSPS
CCCCCCCCC
2.23SysPTM
Link-
232PhosphoserinePVMHSPSRK
CCCCCCCCC
13.38PhosphoELM
Link-
232PhosphoserinePVMHSPSRK
CCCCCCCCC
13.38Phosphositeplus
Link-
232PhosphoserinePVMHSPSRK
CCCCCCCCC
13.38SysPTM
Link-
232Phosphoserine.PVMHSPSRK
CCCCCCCCC
13.38UniProtKB
Link-
234PhosphoserineMHSPSRKMT
CCCCCCCCC
47.77Phosphositeplus
Link-
518PhosphoserineSKRPSDSSR
CCCCCCCCC
54.91Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Identification of phosphoproteins and their phosphorylation sites inthe WEHI-231 B lymphoma cell line.";
Shu H., Chen S., Bi Q., Mumby M., Brekken D.L.;
Mol. Cell. Proteomics 3:279-286(2004).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-224 AND SER-232, ANDMASS SPECTROMETRY.
"Large-scale phosphorylation analysis of mouse liver.";
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-224 AND SER-232, ANDMASS SPECTROMETRY.
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry.";
Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.;
J. Proteome Res. 7:5314-5326(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-224, AND MASSSPECTROMETRY.
"The phagosomal proteome in interferon-gamma-activated macrophages.";
Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,Thibault P.;
Immunity 30:143-154(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-224, AND MASSSPECTROMETRY.
"Large scale localization of protein phosphorylation by use ofelectron capture dissociation mass spectrometry.";
Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.;
Mol. Cell. Proteomics 8:904-912(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-224 AND SER-232, ANDMASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures