Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Sorting nexin-5  

UniProtKB / Swiss-Prot ID :  SNX5_HUMAN

Gene Name (Synonyms) : 
SNX5  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Early endosome membrane; Peripheral membrane protein; Cytoplasmic side. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm. Cell projection, phagocytic cup. 

Protein Function :  May be involved in several stages of intracellular trafficking. Plays a role in macropinocytosis. Plays a role in the internalization of EGFR after EGF stimulation. 

Protein Sequence MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHE...
Predicted Secondary Structure CCCCHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCEEEEEEEEECCCCCCCCCCEEEEEHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAVPE
---CCCCHH
19.71UniProtKB
Link-
20PhosphoserineSKLRSVSVD
CCCCCCCCC
29.22Phosphositeplus
Link-
118Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GSMTKEEFA
CCCCCHHHH
46.75Phosphositeplus
Link-
151PhosphoserineLQRLSSHPV
HHHHHCCCC
28.87HPRD
Link-
151PhosphoserineLQRLSSHPV
HHHHHCCCC
28.87Phosphositeplus
Link-
152PhosphoserineQRLSSHPVL
HHHHCCCCC
36.08HPRD
Link-
152PhosphoserineQRLSSHPVL
HHHHCCCCC
36.08Phosphositeplus
Link-
157PhosphoserineHPVLSKDRN
CCCCCCCCC
32.51HPRD
Link-
157PhosphoserineHPVLSKDRN
CCCCCCCCC
32.51Phosphositeplus
Link-
180Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RKNTKEMFG
CCCCCCCCC
57.48Phosphositeplus
Link-
188Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GGFFKSVVK
CCCCCCCCC
39.83Phosphositeplus
Link-
192Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KSVVKSADE
CCCCCCCCC
37.46Phosphositeplus
Link-
275N6-acetyllysineELFEKLRKV
HHHHHHHHH
46.38HPRD
Link-
275N6-acetyllysineELFEKLRKV
HHHHHHHHH
46.38Phosphositeplus
Link-
275N6-acetyllysine.ELFEKLRKV
HHHHHHHHH
46.38UniProtKB
Link-
290Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DEDLKLTEL
HHHHHHHHH
66.73Phosphositeplus
Link-
298PhosphotyrosineLLRYYMLNI
HHHHHHHHH
6.68HPRD
Link-
314Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YRRTKALID
HHHHHHHHH
39.11Phosphositeplus
Link-
319PhosphotyrosineALIDYENSN
HHHHHHHHH
15.26Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CLH2_HUMANin vivo
yeast 2-hybrid
HPRD:10439HPRD15133132
FANCA_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:10439HPRD10600472
- top -

Disease Reference
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-275, AND MASS SPECTROMETRY.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures