Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  15 kDa calcium-binding protein  

UniProtKB / Swiss-Prot ID :  SP15_HEMPU

Gene Name (Synonyms) :  -
 

Species :  Hemicentrotus pulcherrimus (Sea urchin) (Strongylocentrotuspulcherrimus). 

Subcellular Localization :  Nucleus. Cytoplasm, cytoskeleton, spindle. Note=Nuclei of fertilized eggs and mitotic apparatus of dividing eggs. 

Protein Function :  May play an important role in mitosis of sea urchin egg. May function as a Ca(2+)-dependent intracellular modulator of microtubule assembly. 

Protein Sequence AVQLVFTDAEKAEFKFGFKSKDGDNSITAKELGEFLESAGKSFSEEQLAQMISDVDTDKSGTIEFSEMLM...
Predicted Secondary Structure CCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCEEEHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures