Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Sperm-associated antigen 7  

UniProtKB / Swiss-Prot ID :  SPAG7_MOUSE

Gene Name (Synonyms) : 
Spag7  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Nucleus (Potential). 

Protein Function :   

Protein Sequence MADLLGSILSSMEKPPSLGDQESRRKAREQAARLKKLQEQDKQQKVEFRKRMEKEVSDFIQDSGQVKKKF...
Predicted Secondary Structure CHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
114PhosphoserineEFAPSDEEL
CCCCCHHHH
54.98PhosphoELM
Link-
114PhosphoserineEFAPSDEEL
CCCCCHHHH
54.98Phosphositeplus
Link-
114Phosphoserine.EFAPSDEEL
CCCCCHHHH
54.98UniProtKB
Link-
158PhosphoserinePAVVSPASD
CEEECCCHH
14.24Phosphositeplus
Link-
202PhosphoserineRDTRSIEEA
CHHHHHHHH
36.12Phosphositeplus
Link-
219PhosphoserineRLRQSGEEL
HHHHHHCCC
41.56Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"The phagosomal proteome in interferon-gamma-activated macrophages.";
Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,Thibault P.;
Immunity 30:143-154(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-114, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures