Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Streptopain  

UniProtKB / Swiss-Prot ID :  SPEB_STRPY

Gene Name (Synonyms) : 
speB  

Species :  Streptococcus pyogenes. 

Subcellular Localization :  Secreted. 

Protein Function :  Important streptococcal virulence factor which cleaves human fibronectin and degrades vitronectin. Also cleaves human IL1B precursor to form biologically active IL1B. Can induce apoptosis in human monocytes and epithelial cells in vitro, and reduces phagocytic activity in monocytic cells. Thus, may play a role in bacterial colonization, invasion, and inhibition of wound healing. 

Protein Sequence MNKKKLGIRLLSLLALGGFVLANPVFADQNFARNEKEAKDSAITFIQKSAAIKAGARSAEDIKLDKVNLG...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHEEEEEEECC...
Protein Variant
LocationDescription
17G -> S (in strain: MGAS 1896).
80V -> I (in strain: MGAS 168).
111A -> V (in strain: MGAS 165, 168, 429,659, 660, 796, 800, 1719, 1838, 1882,
137T -> I (in strain: MGAS 650).
154D -> N (in strain: MGAS 684).
211L -> V (in strain: MGAS 366, 427, 758,1294, 1911, 1914A and 1991).
305I -> V (in strain: MGAS 1901 and Sv).
308S -> G (in strain: MGAS 429, 659, 807,1226, 1719, 1832, 1842, 1871, 1872, 2017
317A -> S (in strain: MGAS 165, 168, 289,302, 1233 and 1898).
384G -> D (in strain: MGAS 1871).
394V -> I (in strain: MGAS 366 and 1294).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
192Cysteine methyl disulfide; in zymogenform.AATGCVATA
HHHHHHHHH
1.31UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures