Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  SPATS2-like protein  

UniProtKB / Swiss-Prot ID :  SPS2L_HUMAN

Gene Name (Synonyms) : 
SPATS2L, DNAPTP6 SP1224  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Nucleus, nucleolus. Note=During oxidative stress as well as UV irradiation, energy deprivation or heat shock, relocalizes to cytoplasmic stress granules. In the nucleus, found in structures lacking NPM1. 

Protein Function :   

Protein Sequence MAELNTHVNVKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQAFVDGSAIQVLKEWNMTGKKKNNKR...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAELNT
---
29.95UniProtKB
Link-
15PhosphotyrosineKEKIYAVRS
15.31Phosphositeplus
Link-
120PhosphoserineSSTDSANEK
32.84HPRD
Link-
120PhosphoserineSSTDSANEK
32.84Phosphositeplus
Link-
120Phosphoserine.SSTDSANEK
32.84UniProtKB
Link-
141PhosphoserineLEEPSKALR
33.56HPRD
Link-
159PhosphoserineQQKLSLDGN
31.30Phosphositeplus
Link-
455PhosphoserineKSQGSGNEA
30.70HPRD
Link-
455PhosphoserineKSQGSGNEA
30.70Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-120, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures