Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Serine--pyruvate aminotransferase  

UniProtKB / Swiss-Prot ID :  SPYA_HUMAN

Gene Name (Synonyms) : 
AGXT, AGT1, SPAT  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Peroxisome. Mitochondrion matrix. Note=Except in some HP1 patients where AGT is found in the mitochondrial matrix. 

Protein Function :   

Protein Sequence MASHKLLVTPPKALLKPLSIPNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMYQIMDEIKEGIQYVFQT...
Predicted Secondary Structure CCCCCCCCCCHHHHHHHCCCCCCEEECCCCCCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCC...
Protein Variant
LocationDescription
9T -> N (in HP1). VAR_060547
11P -> L (common polymorphism; reduction ofspecific activity in vitro; causes
22N -> S (in dbSNP:rs34885252). VAR_048236
41G -> R (in HP1; protein destabilizationand loss of activity in the presence of
41G -> V (in HP1). VAR_010969
82G -> E (in HP1; abolishes catalyticactivity by interfering with pyridoxal
82G -> R (in HP1). VAR_060548
95E -> EE (in HP1). VAR_010970
108W -> R (in HP1). VAR_060549
112A -> D (in HP1). VAR_060550
116G -> R (in HP1). VAR_010971
139Missing (in HP1). VAR_060551
152F -> I (in HP1; protein destabilizationand loss of activity in the presence of
153L -> V (in HP1). VAR_060552
156G -> R (in HP1). VAR_010972
158S -> L (in HP1). VAR_060553
161G -> R (in HP1). VAR_060554
170G -> R (in HP1; causes mistargeting whenassociated with L-11).
173C -> Y (in HP1). VAR_060555
183D -> N (in HP1). VAR_010973
187S -> F (in HP1). VAR_000591
190G -> R (in HP1). VAR_060556
195M -> R (in HP1). VAR_060557
201D -> E (in HP1). VAR_060558
205S -> P (in HP1). VAR_000592
218S -> L (in HP1). VAR_060559
233R -> C (in HP1). VAR_008879
233R -> H (in HP1). VAR_008880
233R -> L (in HP1). VAR_060560
243D -> H (in HP1). VAR_060561
244I -> T (in HP1; prevalent mutation in theCanary islands; protein misfolding and
253C -> R (in HP1). VAR_060562
279I -> M (in HP1). VAR_060563
279I -> T. VAR_060564
280A -> V. VAR_060565
287S -> T (in HP1). VAR_060566
289R -> C (in HP1). VAR_060567
295A -> T (in dbSNP:rs13408961). VAR_048237
296Missing (in HP1). VAR_060568
298L -> P (in HP1). VAR_060569
326V -> I. VAR_060570
336V -> D (in HP1). VAR_060571
340I -> M (common polymorphism; associatedwith hyperoxaluria; dbSNP:rs4426527).
350G -> D (in HP1). VAR_060572
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
209N6-(pyridoxal phosphate)lysine.SGSQKALNA
ECCCCEECC
57.44UniProtKB
Link
260PhosphotyrosineQPRMYHHTI
CCCCCCCCC
7.54Phosphositeplus
Link
297PhosphotyrosineEAAAYLHGR
HHHHHHHHH
8.43Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
Q49AC6_HUMANphysical interactionMINT-64297MINT16169070
PEX5_HUMANin vivoHPRD:05048HPRD15911627
SNCAP_HUMANyeast 2-hybridHPRD:05048HPRD16169070
DLDH_HUMANENSP00000302620STRING
SPTC2_HUMANENSP00000302620STRING
SYSM_HUMANENSP00000302620STRING
ODPX_HUMANENSP00000302620STRING
AGT2_HUMANENSP00000302620STRING
SYSC_HUMANENSP00000302620STRING
SYSC_HUMANENSP00000302620STRING
KBL_HUMANENSP00000302620STRING
SDHL_HUMANENSP00000302620STRING
SYAC_HUMANENSP00000302620STRING
SPTC1_HUMANENSP00000302620STRING
SERB_HUMANENSP00000302620STRING
ODP2_HUMANENSP00000302620STRING
ODPAT_HUMANENSP00000302620STRING
ODPAT_HUMANENSP00000302620STRING
ODPAT_HUMANENSP00000302620STRING
ODPB_HUMANENSP00000302620STRING
GRHPR_HUMANENSP00000302620STRING
SOX_HUMANENSP00000302620STRING
GLYC_HUMANENSP00000302620STRING
GLYM_HUMANENSP00000302620STRING
CBS_HUMANENSP00000302620STRING
- top -

Disease Reference
Kegg disease
OMIM disease
259900Hyperoxaluria primary 1 (HP1)
Drug Reference
DrugBank
DB00145Glycine
DB00160L-Alanine
DB00133L-Serine
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures