Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Serine racemase  

UniProtKB / Swiss-Prot ID :  SRR_SCHPO

Gene Name (Synonyms) : 
SRR SPCC320.14, SPCC330.15c  

Species :  Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). 

Subcellular Localization :   

Protein Function :  Catalyzes the synthesis of D-serine from L-serine. Has dehydratase activity towards both L-serine and D-serine. 

Protein Sequence MSDNLVLPTYDDVASASERIKKFANKTPVLTSSTVNKEFVAEVFFKCENFQKMGAFKFRGALNALSQLNE...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
57Lysino-D-alanine (Lys); alternate.MGAFKFRGA
33.35UniProtKB
Link
57N6-(pyridoxal phosphate)lysine;alternate.MGAFKFRGA
33.35UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures