Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Sulfotransferase 1A1  

UniProtKB / Swiss-Prot ID :  ST1A1_HUMAN

Gene Name (Synonyms) : 
SULT1A1, STP, STP1 OK/SW-cl.88  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N- hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. 

Protein Sequence MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKC...
Predicted Secondary Structure CCCCCHHCCCCCCEEECCCCHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHHH...
Protein Variant
LocationDescription
37R -> Q. VAR_009302
151E -> D (in dbSNP:rs1042014). VAR_028721
151E -> Q (in dbSNP:rs1042011). VAR_057339
213R -> H (in allele SULT1A1*2; commonpolymorphism; has a lower activity;
223V -> M (in dbSNP:rs1801030). VAR_009303
235N -> T (in dbSNP:rs35728980). VAR_014889
282E -> K (in dbSNP:rs36043491). VAR_061886
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
85Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FLEFKAPGI
EEEECCCCC
44.27Phosphositeplus
Link
97Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)METLKDTPA
HHHHHCCCC
67.96Phosphositeplus
Link
106N6-acetyllysinePRLLKTHLP
CCEEECCCC
38.19HPRD
Link
106N6-acetyllysinePRLLKTHLP
CCEEECCCC
38.19Phosphositeplus
Link
122Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LLDQKVKVV
HHHCCCEEE
43.63Phosphositeplus
Link
193PhosphotyrosineLYLFYEDMK
EEEEHHHHH
14.39Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00316Acetaminophen
DB00675Tamoxifen
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures