Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Bile salt sulfotransferase  

UniProtKB / Swiss-Prot ID :  ST2A1_HUMAN

Gene Name (Synonyms) : 
SULT2A1, HST, STD  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. 

Protein Sequence MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVP...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCCCHHCCCC...
Protein Variant
LocationDescription
63A -> P (in dbSNP:rs11569681). VAR_052520
261A -> T (in dbSNP:rs11569679). VAR_052521
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
177N6-acetyllysineMREEKNFLL
HHCCCCEEE
48.52Phosphositeplus
Link
184PhosphotyrosineLLLSYEELK
EEEEHHHHH
17.25Phosphositeplus
Link
251PhosphoserineRKGVSGDWK
ECCCCCCCC
39.44HPRD
Link
251PhosphoserineRKGVSGDWK
ECCCCCCCC
39.44Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ST2A1_HUMANin vitroHPRD:00502HPRD11172807
10854859
3BHS1_HUMANENSP00000222002STRING
NR1I2_HUMANENSP00000222002STRING
NR1I2_HUMANENSP00000222002STRING
NR1I2_HUMANENSP00000222002STRING
PAPS2_HUMANENSP00000222002STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB05812Abiraterone
DB00316Acetaminophen
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures