Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Sulfotransferase family cytosolic 2B member 1  

UniProtKB / Swiss-Prot ID :  ST2B1_HUMAN

Gene Name (Synonyms) : 
SULT2B1, HSST2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Microsome. Nucleus. Note=Phosphorylation of Ser-348 is required for translocation to the nucleus. 

Protein Function :  Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids like DHEA. Isoform 1 preferentially sulfonates cholesterol, and isoform 2 avidly sulfonates pregnenolone but not cholesterol. 

Protein Sequence MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPK...
Predicted Secondary Structure CCCCCCCCCCCHHCCCHHHHHHHHCCCCCCEEEEECCCHHHHHCCHHHHHHHHHHCCCCCCCEEEEECCC...
Protein Variant
LocationDescription
51L -> S (in dbSNP:rs16982149). VAR_020887
240V -> I (in dbSNP:rs2302947). VAR_021988
345P -> L (in dbSNP:rs17842463). VAR_020888
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
132PhosphothreonineIQIFTKAFF
HHHCCHHHH
24.08HPRD
Link
348PhosphoserineRPNSSPSPS
CCCCCCCCC
35.72Phosphositeplus
Link-
348Phosphoserine.RPNSSPSPS
CCCCCCCCC
35.72UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
AL2SB_HUMANphysical interactionMINT-67791MINT16189514
Q8N1B6_HUMANphysical interactionEBI-758227
intact16189514
AL2SB_HUMANyeast 2-hybridHPRD:04991HPRD16189514
ST1E1_HUMANyeast 2-hybridHPRD:04991HPRD16189514
3BHS1_HUMANENSP00000201586STRING
RASH_HUMANENSP00000201586STRING
PAPS2_HUMANENSP00000201586STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Site-directed mutagenesis of human cytosolic sulfotransferase (SULT)2B1b to phospho-mimetic Ser348Asp results in an isoform with increasedcatalytic activity.";
Salman E.D., He D., Runge-Morris M., Kocarek T.A., Falany C.N.;
J. Steroid Biochem. Mol. Biol. 127:315-323(2011).
Cited for: BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, PHOSPHORYLATIONAT SER-348, AND MUTAGENESIS OF SER-347; SER-348; SER-352 AND SER-357.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures