Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Serine/threonine-protein kinase 38  

UniProtKB / Swiss-Prot ID :  STK38_MOUSE

Gene Name (Synonyms) : 
Stk38, Ndr1  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Nucleus (By similarity). Cytoplasm (By similarity). 

Protein Function :  Negative regulator of MAP3K1/2 signaling. Converts MAP3K2 from its phosphorylated form to its non-phosphorylated form and inhibits autophosphorylation of MAP3K2 (By similarity). 

Protein Sequence MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHA...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCEEEEHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCCHHCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
264PhosphoserineQNMNSKRKA
CCCCCHHHH
24.06Phosphositeplus
Link-
281PhosphoserineQLAFSTVGT
CEEEEECCC
19.31Phosphositeplus
Link-
443PhosphotyrosineVFINYTYKR
CCCCCCCCC
13.46Phosphositeplus
Link-
444PhosphothreonineFINYTYKRF
CCCCCCCCC
20.34Phosphositeplus
Link-
452PhosphothreonineFEGLTARGA
CCCCCCCCC
25.76Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures