Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cysteine--tRNA ligase, cytoplasmic  

UniProtKB / Swiss-Prot ID :  SYCC_HUMAN

Gene Name (Synonyms) : 
CARS  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :   

Protein Sequence MADSSGQQGKGRRVQPQWSPPAGTQPCRLHLYNSLTRNKEVFIPQDGKKVTWYCCGPTVYDASHMGHARS...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCEECCCCCCCCCEEEEEEECCCCCCCCCCCCCHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
19Phosphoserine.QPQWSPPAG
CCCCCCCCC
18.76UniProtKB
Link-
34PhosphoserineHLYNSLTRN
EEEECCCCE
19.98HPRD
Link-
34PhosphoserineHLYNSLTRN
EEEECCCCE
19.98Phosphositeplus
Link-
239PhosphothreoninePDVLTRVSE
CCCCCEECC
28.95HPRD
Link-
239PhosphothreoninePDVLTRVSE
CCCCCEECC
28.95Phosphositeplus
Link-
260PhosphotyrosineVDNGYGYVS
HHCCCEEEE
16.13HPRD
Link-
260PhosphotyrosineVDNGYGYVS
HHCCCEEEE
16.13Phosphositeplus
Link-
260Phosphotyrosine.VDNGYGYVS
HHCCCEEEE
16.13UniProtKB
Link-
295Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VGDQKALQE
HHHHHHHHH
56.66Phosphositeplus
Link-
307PhosphoserineDLSISADRL
CCCCCCCCC
22.27HPRD
Link-
307PhosphoserineDLSISADRL
CCCCCCCCC
22.27Phosphositeplus
Link-
482Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GQFEKWGEE
CCCCCCCHH
62.88Phosphositeplus
Link-
503N6-acetyllysineTAIHKALCD
HHHHHHHHH
36.62HPRD
Link-
503N6-acetyllysineTAIHKALCD
HHHHHHHHH
36.62Phosphositeplus
Link-
503N6-acetyllysine.TAIHKALCD
HHHHHHHHH
36.62UniProtKB
Link-
746PhosphoserineAQNGSFQ
HHCCCCC
28.20HPRD
Link-
746PhosphoserineAQNGSFQ
HHCCCCC
28.20PhosphoELM
Link-
746PhosphoserineAQNGSFQ
HHCCCCC
28.20Phosphositeplus
Link-
746PhosphoserineAQNGSFQ
HHCCCCC
28.20SysPTM
Link-
746Phosphoserine.AQNGSFQ
HHCCCCC
28.20UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
AATM_HUMANENSP00000278224STRING
AATM_HUMANENSP00000278224STRING
CDO1_HUMANENSP00000278224STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00151L-Cysteine
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-503, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells.";
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.;
Nat. Biotechnol. 23:94-101(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-260, AND MASSSPECTROMETRY.
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-746, AND MASSSPECTROMETRY.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures