Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Phenylalanine--tRNA ligase alpha subunit  

UniProtKB / Swiss-Prot ID :  SYFA_HUMAN

Gene Name (Synonyms) : 
FARSA, FARS, FARSL, FARSLA  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm (By similarity). 

Protein Function :   

Protein Sequence MADGQVAELLLRRLEASDGGLDSAELAAELGMEHQAVVGAVKSLQALGEVIEAELRSTKHWELTAEGEEI...
Predicted Secondary Structure CCCCHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEEEEEEEEEECHHHHHH...
Protein Variant
LocationDescription
341Q -> R (in dbSNP:rs35087277). VAR_052641
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MADGQV
---CCCCHH
29.64UniProtKB
Link-
59Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LRSTKHWEL
EEEEEEEEE
48.22Phosphositeplus
Link-
101Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LPSGKVGFS
HHHHHHHHH
43.45Phosphositeplus
Link-
106Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VGFSKAMSN
HHHHHHHHH
45.94Phosphositeplus
Link-
117Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IRVDKSAAD
CCHHHHHHH
38.85Phosphositeplus
Link-
150Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GQAEKLGEK
CCCCCCHHH
65.88Phosphositeplus
Link-
177Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YWVSKGSAF
HHHHHHHHH
47.46Phosphositeplus
Link-
187Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TSISKQETE
HHHHHHHHH
50.94Phosphositeplus
Link
193PhosphoserineETELSPEMI
HHHHHHHHH
16.75HPRD
Link
193PhosphoserineETELSPEMI
HHHHHHHHH
16.75Phosphositeplus
Link
193PhosphoserineETELSPEMI
HHHHHHHHH
16.75SysPTM
Link
193Phosphoserine.ETELSPEMI
HHHHHHHHH
16.75UniProtKB
Link
301PhosphoserineKRTHSQGGY
HHHCCCCCC
29.88HPRD
Link
301PhosphoserineKRTHSQGGY
HHHCCCCCC
29.88Phosphositeplus
Link
311Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SQGYKYNWK
CCCCCCCCC
38.64Phosphositeplus
Link
311N6-acetyllysineSQGYKYNWK
CCCCCCCCC
38.64HPRD
Link
311N6-acetyllysineSQGYKYNWK
CCCCCCCCC
38.64Phosphositeplus
Link
311N6-acetyllysine.SQGYKYNWK
CCCCCCCCC
38.64UniProtKB
Link
315Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KYNWKLDEA
CCCCCHHHH
42.28Phosphositeplus
Link
343Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LAQKKPFTP
HHHHCCCCC
33.03Phosphositeplus
Link
349Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FTPVKYFSI
CCCEEEEEC
41.61Phosphositeplus
Link
397Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EFFTKLGIT
HHHHHHCCE
39.29Phosphositeplus
Link
406Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QLRFKPAYN
EEEEECCCC
23.46Phosphositeplus
Link
468Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PTMIKYGIN
HHHHHCCCH
26.97Phosphositeplus
Link
481Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LVGHKVNLQ
HHCCCCHHH
27.22Phosphositeplus
Link
488PhosphotyrosineLQMVYDSPL
HHHHHCCCC
12.83Phosphositeplus
Link
504PhosphothreonineRPPPTQEAA
CCCCCCCCC
44.83Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
Q9BV64_HUMANphysical interactionMINT-65368MINT16169070
HNRPR_HUMANyeast 2-hybridHPRD:04227HPRD16169070
AATM_HUMANENSP00000320309STRING
AATM_HUMANENSP00000320309STRING
SYFB_HUMANENSP00000320309STRING
PH4H_HUMANENSP00000320309STRING
ATTY_HUMANENSP00000320309STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00120L-Phenylalanine
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-311, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle.";
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.;
Mol. Cell 31:438-448(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-193, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures