Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Histidine--tRNA ligase, cytoplasmic  

UniProtKB / Swiss-Prot ID :  SYHC_HUMAN

Gene Name (Synonyms) : 
HARS, HRS  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :   

Protein Sequence MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQM...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHCCEEEECCCCCCCCCCHHH...
Protein Variant
LocationDescription
399A -> V (in dbSNP:rs34732372). VAR_061908
454Y -> S (in USH3B). VAR_067918
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAERAA
---CCHHHH
18.25UniProtKB
Link
42Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LLKLKAQLG
HHHHHHHHC
32.28Phosphositeplus
Link
51Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PDESKQKFV
CCCHHCCEE
56.30Phosphositeplus
Link
75Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AVREKVFDV
HHHHHHHHH
37.32Phosphositeplus
Link-
94PhosphothreonineEVIDTPVFE
CEECCCCCC
15.38Phosphositeplus
Link-
106Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TLMGKYGED
HHHHCCCCC
35.80Phosphositeplus
Link-
112Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GEDSKLIYD
CCCCCCEEE
51.75Phosphositeplus
Link-
118Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IYDLKDQGG
EEEEEECCC
45.14Phosphositeplus
Link-
250Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WEEVKNEMV
HHHHHHHHH
50.93Phosphositeplus
Link-
257Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MVGEKGLAP
HHHHCCCCH
53.98Phosphositeplus
Link-
270PhosphotyrosineRIGDYVQQH
HHHHHHHHC
8.57Phosphositeplus
Link-
288Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LQDPKLSQN
HHCCCCCCC
69.89Phosphositeplus
Link-
293Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LSQNKQALE
CCCCHHHHH
29.34Phosphositeplus
Link-
363PhosphotyrosineAGGRYDGLV
CCCCHHHHH
20.03HPRD
Link-
373Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MFDPKGRKV
HCCCCCCCC
73.52Phosphositeplus
Link-
403Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ALEEKIRTT
CCCCCCCCC
28.28Phosphositeplus
Link-
418Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ASAQKKLLE
EECCHHHHH
45.14Phosphositeplus
Link-
443N6-acetyllysineELLYKKNPK
EEECCCCCC
46.15HPRD
Link-
443N6-acetyllysineELLYKKNPK
EEECCCCCC
46.15Phosphositeplus
Link-
443N6-acetyllysine.ELLYKKNPK
EEECCCCCC
46.15UniProtKB
Link-
499Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VEEIKRRTG
HHHHHHHHH
38.82Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
TNIK_HUMANphysical interactionEBI-1105832
intact17043677
SYTC_HUMANENSP00000304668STRING
DCHS_HUMANENSP00000304668STRING
EF1G_HUMANENSP00000304668STRING
CNDP1_HUMANENSP00000304668STRING
- top -

Disease Reference
Kegg disease
OMIM disease
614504Usher syndrome 3B (USH3B)
Drug Reference
DrugBank
DB00117L-Histidine
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-443, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures