Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  General transcription factor IIF subunit 1  

UniProtKB / Swiss-Prot ID :  T2FA_RAT

Gene Name (Synonyms) : 
Gtf2f1  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Nucleus (By similarity). 

Protein Function :  TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation (By similarity). 

Protein Sequence MAALGSSSQNVTEYVVRVPKNTAKRYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSE...
Predicted Secondary Structure CCCCCCCCCCEEEEEEECCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
348PhosphoserineDSDSSEESD
CCCCCCCCC
50.83Phosphositeplus
Link-
351PhosphoserineSSEESDIDS
CCCCCCCCC
35.50Phosphositeplus
Link-
355PhosphoserineSDIDSETSS
CCCCCCCCC
43.01Phosphositeplus
Link-
358PhosphoserineDSETSSALF
CCCCCCCCC
15.01Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures