Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Transmembrane anterior posterior transformation protein 1 homolog  

UniProtKB / Swiss-Prot ID :  TAPT1_HUMAN

Gene Name (Synonyms) : 
TAPT1, CMVFR  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Membrane; Multi-pass membrane protein (Potential). 

Protein Function :  May act as a downstream effector of HOXC8 possibly by transducing or transmitting extracellular information required for axial skeletal patterning during development (By similarity). In case of infection, may act as a fusion receptor for cytomegalovirus (HCMV) strain AD169. 

Transmembrane Topology (topPTM) : TAPT1_HUMAN 

Protein Sequence MAGVGDAAAPGEGGGGGVDGPQRDGRGEAEQPGGSGGQGPPPAPQLTETLGFYESDRRRERRRGRTELSL...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
465E -> K (in dbSNP:rs35606284). VAR_042568
522N -> S (in dbSNP:rs16893137). VAR_042569
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAGVGD
---
22.75UniProtKB
Link-
90Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HNEAKYTER
46.67Phosphositeplus
Link-
388Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SSRQKNAYT
42.30Phosphositeplus
Link-
538PhosphothreonineEKDITQDNS
39.75HPRD
Link-
542PhosphoserineTQDNSELKH
53.23HPRD
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures