Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Tubulin-specific chaperone A  

UniProtKB / Swiss-Prot ID :  TBCA_HUMAN

Gene Name (Synonyms) : 
TBCA  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm, cytoskeleton. 

Protein Function :  Tubulin-folding protein; involved in the early step of the tubulin folding pathway. 

Protein Sequence MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRR...
Predicted Secondary Structure CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
28N6-acetyllysineVMYEKEAKQ
HHHHHHHHH
45.55HPRD
Link
28N6-acetyllysineVMYEKEAKQ
HHHHHHHHH
45.55Phosphositeplus
Link
28N6-acetyllysine.VMYEKEAKQ
HHHHHHHHH
45.55UniProtKB
Link
48PhosphotyrosineDGENYDIKK
CCCCCCHHH
18.10Phosphositeplus
Link
51Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NYDIKKQAE
CCCHHHHHH
35.62Phosphositeplus
Link
52Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YDIKKQAEI
CCHHHHHHH
55.89Phosphositeplus
Link
60PhosphoserineILQESRMMI
HHHHHHHHH
16.71HPRD
Link
60PhosphoserineILQESRMMI
HHHHHHHHH
16.71Phosphositeplus
Link
86Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LENEKDLEE
HHHHCCHHH
78.26Phosphositeplus
Link
95Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AEEYKEARL
HHHHHHHHH
48.45Phosphositeplus
Link
105Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LDSVKLEA
HHHHHCCC
44.56Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-28, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures