Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Tat-binding homolog 7  

UniProtKB / Swiss-Prot ID :  TBP7_YEAST

Gene Name (Synonyms) : 
YTA7 YGR270W  

Species :  Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MARNLRNRRGSDVEDASNAKVGYETQIKDENGIIHTTTRSLRKINYAEIEKVFDFLEDDQVMDKDETPVD...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCEEEECHHHHHHCCHHHHHHHHHHHHCCHHHCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
11PhosphoserineNRRGSDVED
CCCCCCCCC
36.35SysPTM
Link-
11Phosphoserine.NRRGSDVED
CCCCCCCCC
36.35UniProtKB
Link-
17PhosphoserineVEDASNAKV
CCCCCCCCC
50.03SysPTM
Link-
17Phosphoserine.VEDASNAKV
CCCCCCCCC
50.03UniProtKB
Link-
94PhosphoserineVDLVSPHEN
CCCCCCCCC
28.03SysPTM
Link-
94Phosphoserine.VDLVSPHEN
CCCCCCCCC
28.03UniProtKB
Link-
212PhosphothreonineRHPETPPPV
CCCCCCCHH
45.61SysPTM
Link-
212Phosphothreonine.RHPETPPPV
CCCCCCCHH
45.61UniProtKB
Link-
241PhosphoserineENDNSRNEA
CCCCCCCCC
39.07SysPTM
Link-
241Phosphoserine.ENDNSRNEA
CCCCCCCCC
39.07UniProtKB
Link-
259PhosphoserineLQEDSPIRE
CCCCCCHHH
22.83SysPTM
Link-
259Phosphoserine.LQEDSPIRE
CCCCCCHHH
22.83UniProtKB
Link-
285PhosphoserinePLTASNAEE
CHHHHHCCC
31.19SysPTM
Link-
285Phosphoserine.PLTASNAEE
CHHHHHCCC
31.19UniProtKB
Link-
304PhosphoserineFHNPSPARR
CCCCCCCCC
36.19SysPTM
Link-
304Phosphoserine.FHNPSPARR
CCCCCCCCC
36.19UniProtKB
Link-
316PhosphoserineGWNASQNSG
CCCCCCCCC
27.04SysPTM
Link-
316Phosphoserine.GWNASQNSG
CCCCCCCCC
27.04UniProtKB
Link-
941PhosphoserineQKVTSNAAP
HHCCCCCHH
27.71SysPTM
Link-
941Phosphoserine.QKVTSNAAP
HHCCCCCHH
27.71UniProtKB
Link-
1142PhosphoserineAKEQSQENI
CCCCCCHHC
40.32SysPTM
Link-
1142Phosphoserine.AKEQSQENI
CCCCCCHHC
40.32UniProtKB
Link-
1256PhosphoserineENEDSLQTQ
CCCCCHHHH
19.05SysPTM
Link-
1256Phosphoserine.ENEDSLQTQ
CCCCCHHHH
19.05UniProtKB
Link-
1259PhosphothreonineDSLQTQVTE
CCHHHHHHC
30.24SysPTM
Link-
1259Phosphothreonine.DSLQTQVTE
CCHHHHHHC
30.24UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis.";
Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.;
Mol. Cell. Proteomics 7:1389-1396(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-11; THR-212; SER-241;SER-259; SER-285; SER-304; SER-316; SER-941; SER-1142; SER-1256 ANDTHR-1259, AND MASS SPECTROMETRY.
"Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae.";
Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.;
J. Proteome Res. 6:1190-1197(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94 AND SER-259, AND MASSSPECTROMETRY.
"Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry.";
Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.;
Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-11 AND SER-17, AND MASSSPECTROMETRY.
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases.";
Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.;
Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-11; THR-212; SER-241;SER-259 AND SER-1142, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures