Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  T-complex protein 1 subunit epsilon  

UniProtKB / Swiss-Prot ID :  TCPE_HUMAN

Gene Name (Synonyms) : 
CCT5, CCTE, KIAA0098  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Cytoplasm, cytoskeleton, centrosome. 

Protein Function :  Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin. 

Protein Sequence MASMGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTV...
Predicted Secondary Structure CCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCEE...
Protein Variant
LocationDescription
146E -> V (in dbSNP:rs11557652). VAR_052267
147H -> R (in HSNSP). VAR_030658
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MASMGT
---CCCCCC
14.28UniProtKB
Link-
12PhosphotyrosineAFDEYGRPF
CCCCCCCEE
21.93HPRD
Link-
12PhosphotyrosineAFDEYGRPF
CCCCCCCEE
21.93Phosphositeplus
Link-
26PhosphoserineQDRKSRLMG
CCHHHHHHH
31.38HPRD
Link-
26PhosphoserineQDRKSRLMG
CCHHHHHHH
31.38Phosphositeplus
Link-
35Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LEALKSHIM
HHHHHHHHH
47.22Phosphositeplus
Link-
42Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IMAAKAVAN
HHHHHHHHH
33.58Phosphositeplus
Link-
150Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EHLDKISDS
HHHHHHCCC
50.93Phosphositeplus
Link-
160Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LVDIKDTEP
CCCCCCHHH
54.88Phosphositeplus
Link-
170Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IQTAKTTLG
HHHHHHHCC
45.49Phosphositeplus
Link-
181S-nitrosocysteineVVNSCHRQM
HHHHHHHHH
2.30dbSNO
Link-
210Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FELIKVEGK
CEEEEEEEC
47.02Phosphositeplus
Link-
214Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KVEGKVGGR
EEEECCCCC
24.97Phosphositeplus
Link-
223N6-acetyllysineLEDTKLIKG
EECCEEEEE
61.61HPRD
Link-
223N6-acetyllysineLEDTKLIKG
EECCEEEEE
61.61Phosphositeplus
Link-
223N6-acetyllysine.LEDTKLIKG
EECCEEEEE
61.61UniProtKB
Link-
226Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TKLIKGVIV
CEEEEEEEE
58.52Phosphositeplus
Link-
232Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VIVDKDFSH
EEEECCCCC
50.18Phosphositeplus
Link-
232N6-acetyllysineVIVDKDFSH
EEEECCCCC
50.18HPRD
Link-
232N6-acetyllysineVIVDKDFSH
EEEECCCCC
50.18Phosphositeplus
Link-
232N6-acetyllysine.VIVDKDFSH
EEEECCCCC
50.18UniProtKB
Link-
265Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KTKHKLDVT
CCCCCEEEC
48.19Phosphositeplus
Link-
274PhosphotyrosineSVEDYKALQ
CHHHHHHHH
5.67Phosphositeplus
Link-
275Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VEDYKALQK
HHHHHHHHH
55.75Phosphositeplus
Link-
284Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YEKEKFEEM
HHHHHHHHH
69.97Phosphositeplus
Link-
368Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FGTTKDKML
EEECCEEEE
56.01Phosphositeplus
Link-
378Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IEQCKNSRA
EECCCCCCE
58.62Phosphositeplus
Link-
392Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RGGNKMIIE
ECCCHHHHH
34.45Phosphositeplus
Link-
399Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IEEAKRSLH
HHHHHHHHH
45.88Phosphositeplus
Link-
399N6-acetyllysineIEEAKRSLH
HHHHHHHHH
45.88HPRD
Link-
399N6-acetyllysineIEEAKRSLH
HHHHHHHHH
45.88Phosphositeplus
Link-
399N6-acetyllysine.IEEAKRSLH
HHHHHHHHH
45.88UniProtKB
Link-
407S-nitrosocysteineHDALCVIRN
HHHHHHHHH
2.28dbSNO
Link-
483Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ARQVKEMNP
HHHHHCCCC
42.80Phosphositeplus
Link-
502Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TNDMKQQHV
EECHHHCCC
50.06Phosphositeplus
Link-
509PhosphothreonineHVIETLIGK
CCCCCHHHH
16.73HPRD
Link-
509PhosphothreonineHVIETLIGK
CCCCCHHHH
16.73Phosphositeplus
Link-
513Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TLIGKKQQI
CHHHHHHHH
40.18Phosphositeplus
Link-
514Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LIGKKQQIS
HHHHHHHHH
42.07Phosphositeplus
Link-
518PhosphoserineKQQISLATQ
HHHHHHHHH
13.96Phosphositeplus
Link-
521PhosphothreonineISLATQMVR
HHHHHHHHH
23.61Phosphositeplus
Link-
529Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RMILKIDDI
HHHHHHHHH
32.91Phosphositeplus
Link-
535Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DDIRKPGES
HHHHCCCCC
58.68Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
SSA27_HUMANphysical interactionMINT-67964MINT16189514
IMMT_HUMANphysical interactionMINT-63774MINT16169070
M3K3_HUMANphysical interactionMINT-48401MINT14743216
TBC17_HUMANphysical interactionMINT-63776MINT16169070
TBK1_HUMANphysical interactionMINT-49259MINT14743216
RIPK3_HUMANphysical interactionMINT-49094MINT14743216
TBC17_HUMANphysical interactionEBI-734129
intact16169070
ELP1_HUMANphysical interactionEBI-729717
intact16169070
IMMT_HUMANphysical interactionEBI-729720
intact16169070
P53_HUMANphysical interactionEBI-729723
intact16169070
ACTB_HUMANin vitro
in vivo
HPRD:06468HPRD11580269
ACTS_HUMANin vitroHPRD:06468HPRD11580270
ACTA_HUMANin vitroHPRD:06468HPRD11580270
SSA27_HUMANyeast 2-hybridHPRD:06468HPRD16189514
TCPA_HUMANin vitroHPRD:06468HPRD9250675
PHLP_HUMANin vivoHPRD:06468HPRD15889144
TBC17_HUMANyeast 2-hybridHPRD:06468HPRD16169070
TCPD_HUMANENSP00000280326STRING
TCPH_HUMANENSP00000280326STRING
TCPB_HUMANENSP00000280326STRING
ACTB_HUMANENSP00000280326STRING
- top -

Disease Reference
Kegg disease
OMIM disease
256840Neuropathy, hereditary sensory, with spastic paraplegia, autosomal recessive (HSNSP)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-223; LYS-232 AND LYS-399,AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures