Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  T-complex protein 1 subunit theta  

UniProtKB / Swiss-Prot ID :  TCPQ_HUMAN

Gene Name (Synonyms) : 
CCT8, C21orf112, CCTQ, KIAA0002  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Cytoplasm, cytoskeleton, centrosome. 

Protein Function :  Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin. 

Protein Sequence MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAA...
Predicted Secondary Structure CCCCCCCCCCCCEECCCCCEEEECHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCEEEECHHH...
Protein Variant
LocationDescription
4H -> Q (in dbSNP:rs16983693). VAR_052270
409V -> I (in dbSNP:rs8129954). VAR_052271
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MALHVP
---CCCCCC
13.33UniProtKB
Link-
7Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LHVPKAPGF
CCCCCCCCC
67.15Phosphositeplus
Link-
7N6-acetyllysineLHVPKAPGF
CCCCCCCCC
67.15HPRD
Link-
7N6-acetyllysineLHVPKAPGF
CCCCCCCCC
67.15Phosphositeplus
Link-
7N6-acetyllysine.LHVPKAPGF
CCCCCCCCC
67.15UniProtKB
Link-
16Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AQMLKEGAK
CEECCCCCE
49.08Phosphositeplus
Link-
20Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KEGAKHFSG
CCCCEEEEC
56.91Phosphositeplus
Link-
20N6-acetyllysineKEGAKHFSG
CCCCEEEEC
56.91Phosphositeplus
Link-
20N6-acetyllysine.KEGAKHFSG
CCCCEEEEC
56.91UniProtKB
Link-
23PhosphoserineAKHFSGLEE
CEEEECHHH
42.03HPRD
Link-
23PhosphoserineAKHFSGLEE
CEEEECHHH
42.03Phosphositeplus
Link-
23Phosphoserine.AKHFSGLEE
CEEEECHHH
42.03UniProtKB
Link-
30PhosphotyrosineEEAVYRNIQ
HHHHHHHHH
12.65HPRD
Link-
30PhosphotyrosineEEAVYRNIQ
HHHHHHHHH
12.65PhosphoELM
Link-
30PhosphotyrosineEEAVYRNIQ
HHHHHHHHH
12.65Phosphositeplus
Link-
30Phosphotyrosine.EEAVYRNIQ
HHHHHHHHH
12.65UniProtKB
Link-
37Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IQACKELAQ
HHHHHHHHH
59.80Phosphositeplus
Link-
54Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NGMNKMVIN
CCCEEEEEC
26.17Phosphositeplus
Link-
62Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NHLEKLFVT
CCCCCEEEE
54.29Phosphositeplus
Link-
148S-nitrosocysteinePNLVCCSAK
HHHHHCCCC
1.38dbSNO
Link-
149S-nitrosocysteineNLVCCSAKN
HHHHCCCCC
3.27dbSNO
Link-
152Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)CCSAKNLRD
HCCCCCCCC
39.97Phosphositeplus
Link-
171Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SIMSKQYGN
HHCCCCCCC
30.11Phosphositeplus
Link-
173PhosphotyrosineMSKQYGNEV
CCCCCCCHH
26.17HPRD
Link-
173PhosphotyrosineMSKQYGNEV
CCCCCCCHH
26.17Phosphositeplus
Link-
225Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MVFKKETEG
EEEEECCCC
59.40Phosphositeplus
Link-
225Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin).MVFKKETEG
EEEEECCCC
59.40UniProtKB
Link-
227PhosphothreonineFKKETEGDV
EEECCCCCC
54.90HPRD
Link-
227Phosphothreonine.FKKETEGDV
EEECCCCCC
54.90UniProtKB
Link-
232PhosphothreonineEGDVTSVKD
CCCCEEECC
32.32HPRD
Link-
232Phosphothreonine.EGDVTSVKD
CCCCEEECC
32.32UniProtKB
Link-
233PhosphoserineGDVTSVKDA
CCCEEECCC
27.33HPRD
Link-
233Phosphoserine.GDVTSVKDA
CCCEEECCC
27.33UniProtKB
Link-
235Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VTSVKDAKI
CEEECCCEE
52.30Phosphositeplus
Link-
235Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin).VTSVKDAKI
CEEECCCEE
52.30UniProtKB
Link-
260Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TVLIKTAEE
CEEEECHHH
37.21Phosphositeplus
Link-
270Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MNFSKGEEN
HHHHHHHHH
67.23Phosphositeplus
Link-
318N6-acetyllysineRLNSKWDLR
CCCCCCCCE
43.59HPRD
Link-
318N6-acetyllysineRLNSKWDLR
CCCCCCCCE
43.59Phosphositeplus
Link-
318N6-acetyllysine.RLNSKWDLR
CCCCCCCCE
43.59UniProtKB
Link-
326Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RRLCKTVGA
EEEEEECCC
51.33Phosphositeplus
Link-
381PhosphothreonineLRGSTDNLM
EECCCHHHH
31.56Phosphositeplus
Link-
400Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VNTFKVLTR
HHHHHHHHH
34.01Phosphositeplus
Link-
400N6-acetyllysineVNTFKVLTR
HHHHHHHHH
34.01HPRD
Link-
400N6-acetyllysineVNTFKVLTR
HHHHHHHHH
34.01Phosphositeplus
Link-
400N6-acetyllysine.VNTFKVLTR
HHHHHHHHH
34.01UniProtKB
Link-
415PhosphothreonineGGGATEIEL
CHHHHHHHH
40.55Phosphositeplus
Link-
421Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IELAKQITS
HHHHHHHHH
55.66Phosphositeplus
Link-
430S-nitrosocysteineYGETCPGLE
HHHCCCHHH
1.88dbSNO
Link-
440Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YAIKKFAEA
HHHHHHHHH
43.63Phosphositeplus
Link-
459Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NSGVKANEV
HCCCCHHHH
49.36Phosphositeplus
Link-
466Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EVISKLYAV
HHHHHHHHH
34.10Phosphositeplus
Link-
466N6-acetyllysineEVISKLYAV
HHHHHHHHH
34.10HPRD
Link-
466N6-acetyllysineEVISKLYAV
HHHHHHHHH
34.10Phosphositeplus
Link-
466N6-acetyllysine.EVISKLYAV
HHHHHHHHH
34.10UniProtKB
Link-
505PhosphotyrosineYLGKYWAIK
HHHHHHHHH
9.77HPRD
Link-
505PhosphotyrosineYLGKYWAIK
HHHHHHHHH
9.77Phosphositeplus
Link-
505Phosphotyrosine.YLGKYWAIK
HHHHHHHHH
9.77UniProtKB
Link-
528Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IIMAKPAGG
HHHHCCCCC
20.30Phosphositeplus
Link-
537PhosphoserinePKPPSGKKD
CCCCCCCCC
72.30HPRD
Link-
537PhosphoserinePKPPSGKKD
CCCCCCCCC
72.30Phosphositeplus
Link-
540Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PSGKKDWDD
CCCCCCCCC
68.52Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ACTB_HUMANin vitro
in vivo
HPRD:10816HPRD10748209
ACTB_HUMANENSP00000286788STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Substrate and functional diversity of lysine acetylation revealed bya proteomics survey.";
Kim S.C., Sprung R., Chen Y., Xu Y., Ball H., Pei J., Cheng T.,Kho Y., Xiao H., Xiao L., Grishin N.V., White M., Yang X.-J., Zhao Y.;
Mol. Cell 23:607-618(2006).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-20, AND MASS SPECTROMETRY.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-7; LYS-318; LYS-400 ANDLYS-466, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells.";
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.;
Nat. Biotechnol. 23:94-101(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-505, AND MASSSPECTROMETRY.
"Improved titanium dioxide enrichment of phosphopeptides from HeLacells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.";
Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.;
J. Proteome Res. 6:4150-4162(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-227; THR-232 ANDSER-233, AND MASS SPECTROMETRY.
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23, AND MASSSPECTROMETRY.
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23 AND TYR-30, AND MASSSPECTROMETRY.
Ubiquitylation
ReferencePubMed
"Tryptic digestion of ubiquitin standards reveals an improved strategyfor identifying ubiquitinated proteins by mass spectrometry.";
Denis N.J., Vasilescu J., Lambert J.-P., Smith J.C., Figeys D.;
Proteomics 7:868-874(2007).
Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-225 AND LYS-235, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures