Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Telomeric repeat-binding factor 1  

UniProtKB / Swiss-Prot ID :  TERF1_CRIGR

Gene Name (Synonyms) : 
TERF1, TRF1  

Species :  Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). 

Subcellular Localization :  Nucleus (By similarity). Chromosome, telomere (By similarity). Cytoplasm, cytoskeleton, spindle (By similarity). Note=Colocalizes with telomeric DNA in interphase and metaphase cells and is located at chromosome ends during metaphase. Associates with the 

Protein Function :  Binds the telomeric double-stranded TTAGGG repeat and negatively regulates telomere length. Involved in the regulation of the mitotic spindle. Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double- stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways (By similarity). 

Protein Sequence MAEDVSSTAPSPRGCADGRDADPTEEQMAQTQRNDQDQFECQELLECQVQVGAPDEEEEEEEDSGLVAEA...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures