Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  General transcription factor 3C polypeptide 5  

UniProtKB / Swiss-Prot ID :  TF3C5_HUMAN

Gene Name (Synonyms) : 
GTF3C5 CDABP0017  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus. 

Protein Function :  Involved in RNA polymerase III-mediated transcription. Integral, tightly associated component of the DNA-binding TFIIIC2 subcomplex that directly binds tRNA and virus-associated RNA promoters. 

Protein Sequence MAAEAADLGLGAAVPVELRRERRMVCVEYPGVVRDVAKMLPTLGGEEGVSRIYADPTKRLELYFRPKDPY...
Predicted Secondary Structure CCCCCCCCCCCCCCCEEECCCCCEEEEECCCCCCCHHHHHHHHCCHHHHHHHHHCHHHHEEEEECCCCCC...
Protein Variant
LocationDescription
445D -> N (in dbSNP:rs637435). VAR_053727
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAEAA
---CCCCCC
17.63UniProtKB
Link-
38Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RDVAKMLPT
CCHHHHHHH
40.60Phosphositeplus
Link-
58Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ADPTKRLEL
HCHHHHEEE
61.44Phosphositeplus
Link-
182PhosphotyrosineAPVDYFYRP
CCHHHHCCC
11.62Phosphositeplus
Link-
256Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EELRKLFDI
HHHHHHHHH
67.16Phosphositeplus
Link-
270Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RNAVKANIS
HHHHHHHHH
33.05Phosphositeplus
Link-
316PhosphotyrosineDAKIYQVLD
HHHHHHHHH
7.58Phosphositeplus
Link-
339Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DLPVKAKRS
CCCCEECCC
46.37Phosphositeplus
Link-
347PhosphotyrosineSTYNYSLPI
CEEEEEEEE
10.94Phosphositeplus
Link-
354Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PITVKKTSS
EEEEEECCC
41.50Phosphositeplus
Link-
367Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MHDLKQGLG
HHHHHHCCC
48.67Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
TF3B_HUMANin vitroHPRD:16077HPRD10373544
TF3C3_HUMANin vitro
in vivo
HPRD:16077HPRD10373544
TF3C4_HUMANin vitro
in vivo
HPRD:16077HPRD10523658
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures