Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Queuine tRNA-ribosyltransferase  

UniProtKB / Swiss-Prot ID :  TGT_HUMAN

Gene Name (Synonyms) : 
QTRT1, TGT, TGUT  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm (By similarity). Mitochondrion (By similarity). Nucleus (By similarity). Note=Weakly associates with mitochondria, possibly via QTRTD1 (By similarity). 

Protein Function :  Interacts with QTRTD1 to form an active queuine tRNA- ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1- yl)amino)methyl)-7-deazaguanosine) (By similarity). 

Protein Sequence MAGAATQASLESAPRIMRLVAECSRSRARAGELWLPHGTVATPVFMPVGTQATMKGITTEQLDALGCRIC...
Predicted Secondary Structure CEEEEEEECCCCEEEEEEECCCEEECCEEECCCCCCCCCCCCHHHHHHHCCCEEEECHHHCCCCCCHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
139PhosphoserineETLLSPEKS
CCCEEEECC
33.84Phosphositeplus
Link-
231PhosphoserineIGGLSGGES
HHHHHHCCC
48.29HPRD
Link-
231PhosphoserineIGGLSGGES
HHHHHHCCC
48.29Phosphositeplus
Link-
235PhosphoserineSGGESKSQF
HHCCCCCCC
40.66Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CSN6_HUMANphysical interactionEBI-733043
intact16169070
SETB1_HUMANphysical interactionEBI-733046
intact16169070
SH3G3_HUMANphysical interactionEBI-733049
intact16169070
UN119_HUMANphysical interactionEBI-733052
intact16169070
ZBT16_HUMANphysical interactionEBI-733055
intact16169070
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures