Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  3-mercaptopyruvate sulfurtransferase  

UniProtKB / Swiss-Prot ID :  THTM_HUMAN

Gene Name (Synonyms) : 
MPST, TST2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. May have a role in cyanide degradation or in thiosulfate biosynthesis. 

Protein Sequence MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTS...
Predicted Secondary Structure CCHHHHHHHHCCHHHHHHHHCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHCCCCEEEECHHHHHCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
3Phosphoserine--MASPQLC
--CCHHHHH
16.33HPRD
Link-
3Phosphoserine--MASPQLC
--CCHHHHH
16.33Phosphositeplus
Link-
35PhosphoserineLLDASWYLP
EEEEEECCC
18.87HPRD
Link
164Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PAFIKTYED
HHHHHHHHH
38.30Phosphositeplus
Link
250PhosphoserineATCGSGVTA
EEECCCHHH
32.03HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CH60_HUMANphysical interactionDIP:747EDIP7961947
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures