Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  THUMP domain-containing protein 1  

UniProtKB / Swiss-Prot ID :  THUM1_MOUSE

Gene Name (Synonyms) : 
Thumpd1  

Species :  Mus musculus (Mouse). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MATTAQQSPQPVAGKRKGKSQFLPAKRARRGDAGGPRQLEPGLQGILITCNMNERKCVEEAYSLLNEYGD...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
8PhosphoserineTAQQSPQPV
CCCCCCCCC
17.27Phosphositeplus
Link-
8Phosphoserine.TAQQSPQPV
CCCCCCCCC
17.27UniProtKB
Link-
86PhosphoserineDQQPSGSEG
CCCCCCCCC
51.09Phosphositeplus
Link-
86PhosphoserineDQQPSGSEG
CCCCCCCCC
51.09SysPTM
Link-
86Phosphoserine.DQQPSGSEG
CCCCCCCCC
51.09UniProtKB
Link-
88PhosphoserineQPSGSEGED
CCCCCCCCC
46.92Phosphositeplus
Link-
88PhosphoserineQPSGSEGED
CCCCCCCCC
46.92SysPTM
Link-
88Phosphoserine.QPSGSEGED
CCCCCCCCC
46.92UniProtKB
Link-
119PhosphoserineRRFQSVESG
CCCCCEECC
25.74Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"A differential phosphoproteomic analysis of retinoic acid-treated P19cells.";
Smith J.C., Duchesne M.A., Tozzi P., Ethier M., Figeys D.;
J. Proteome Res. 6:3174-3186(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-86 AND SER-88, AND MASSSPECTROMETRY.
"Specific phosphopeptide enrichment with immobilized titanium ionaffinity chromatography adsorbent for phosphoproteome analysis.";
Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H.;
J. Proteome Res. 7:3957-3967(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-86 AND SER-88, AND MASSSPECTROMETRY.
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry.";
Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.;
J. Proteome Res. 7:5314-5326(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-86 AND SER-88, AND MASSSPECTROMETRY.
"Large scale localization of protein phosphorylation by use ofelectron capture dissociation mass spectrometry.";
Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.;
Mol. Cell. Proteomics 8:904-912(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-8; SER-86 AND SER-88,AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures