Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Thy-1 membrane glycoprotein  

UniProtKB / Swiss-Prot ID :  THY1_HUMAN

Gene Name (Synonyms) : 
THY1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor (By similarity). 

Protein Function :  May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. 

Protein Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVP...
Predicted Secondary Structure CCCCHHHHHHHHHHHHHCCCEEEEEHHHHCCCCEEEEEEECCCCCCCEEEEEEEEECCCEEEEEEEECCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
42N-linked (Glc...)CRHENTSSS
EEECCCCCC
38.85HPRD
Link-
42N-linked (GlcNAc...).CRHENTSSS
EEECCCCCC
38.85UniProtKB
Link-
96PhosphoserineSAFTSKDEG
EECCCCCCC
31.49Phosphositeplus
Link-
119N-linked (Glc...)ISSQNVTVL
CCCCEEEEE
33.12HPRD
Link-
119N-linked (GlcNAc...).ISSQNVTVL
CCCCEEEEE
33.12UniProtKB
Link-
139N-linked (GlcNAc...).LLAQNTSWL
EEEECHHHH
30.39UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
FYN_HUMANin vivoHPRD:01769HPRD1351058
LCK_HUMANin vivoHPRD:01769HPRD1351058
THY1_HUMANin vitroHPRD:01769HPRD1347022
ITAV_HUMANin vitro
in vivo
HPRD:01769HPRD15897908
ITB3_HUMANin vitro
in vivo
HPRD:01769HPRD15897908
CD4_HUMANENSP00000284240STRING
IL4_HUMANENSP00000284240STRING
CD8A_HUMANENSP00000284240STRING
ITAM_HUMANENSP00000284240STRING
CD3D_HUMANENSP00000284240STRING
ITB2_HUMANENSP00000284240STRING
ETS1_HUMANENSP00000284240STRING
CO4A5_HUMANENSP00000284240STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-119, AND MASSSPECTROMETRY.
"Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.";
Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M.,Schiess R., Aebersold R., Watts J.D.;
Nat. Biotechnol. 27:378-386(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-42 AND ASN-119, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures