Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Thy-1 membrane glycoprotein  

UniProtKB / Swiss-Prot ID :  THY1_MOUSE

Gene Name (Synonyms) : 
Thy1, Thy-1  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor. 

Protein Function :  May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. 

Protein Sequence MNPAISVALLLSVLQVSRGQKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGI...
Predicted Secondary Structure CCCEEHHHHHHHHHHHHCCCEEEEEHHHHCCCCEEEEEEECCCCCCCCEEEEEEEEECCCEEEEEEEECC...
Protein Variant
LocationDescription
108Q -> R (in allele Thy-1.1).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
20Pyrrolidone carboxylic acid.VSRGQKVTS
HHCCCEEEE
35.62UniProtKB
Link-
42N-linked (GlcNAc...).CRHENNTKD
EEECCCCCC
56.18UniProtKB
Link-
82PhosphoserineRVTLSNQPY
EEEEEECCC
24.85Phosphositeplus
Link-
94N-linked (GlcNAc...).LTLANFTTK
EEEECCCCC
37.60UniProtKB
Link-
118N-linked (GlcNAc...).PMSSNKSIS
CCCCCCEEE
34.48UniProtKB
Link-
131GPI-anchor amidated cysteine.KLVKCGGIS
EEEEEEEEE
4.74UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
GPI-anchor
ReferencePubMed
"Neuronal cell Thy-1 glycoprotein: homology with immunoglobulin.";
Williams A.F., Gagnon J.;
Science 216:696-703(1982).
Cited for: PROTEIN SEQUENCE OF 20-131, PYROGLUTAMATE FORMATION AT GLN-20, ANDGPI-ANCHOR AT CYS-131.
N-linked Glycosylation
ReferencePubMed
"Neuronal cell Thy-1 glycoprotein: homology with immunoglobulin.";
Williams A.F., Gagnon J.;
Science 216:696-703(1982).
Cited for: PROTEIN SEQUENCE OF 20-131, PYROGLUTAMATE FORMATION AT GLN-20, ANDGPI-ANCHOR AT CYS-131.
Pyrrolidone carboxylic acid
ReferencePubMed
"Neuronal cell Thy-1 glycoprotein: homology with immunoglobulin.";
Williams A.F., Gagnon J.;
Science 216:696-703(1982).
Cited for: PROTEIN SEQUENCE OF 20-131, PYROGLUTAMATE FORMATION AT GLN-20, ANDGPI-ANCHOR AT CYS-131.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures