Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Troponin C, skeletal muscle  

UniProtKB / Swiss-Prot ID :  TNNC2_RANES

Gene Name (Synonyms) :  -
 

Species :  Rana esculenta (Edible frog) (Pelophylax esculentus). 

Subcellular Localization :   

Protein Function :  Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments. 

Protein Sequence AQPTDQQMDARSFLSEEMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQTPTKEELDAIIEEVDEDGS...
Predicted Secondary Structure CCCHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCEECHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylalanine.----AQPTD
----CCCHH
35.05UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"The amino-acid sequence of troponin C from frog skeletal muscle.";
van Eerd J.-P., Capony J.-P., Ferraz C., Pechere J.-F.;
Eur. J. Biochem. 91:231-242(1978).
Cited for: PROTEIN SEQUENCE.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures