Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Short transient receptor potential channel 4-associated protein  

UniProtKB / Swiss-Prot ID :  TP4AP_HUMAN

Gene Name (Synonyms) : 
TRPC4AP, C20orf188, TRRP4AP  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control. The DCX(TRUSS) complex specifically mediates the polyubiquitination and subsequent degradation of MYC. Also participates in the activation of NFKB1 in response to ligation of TNFRSF1A, possibly by linking TNFRSF1A to the IKK signalosome. Involved in JNK activation via its interaction with TRAF2. Also involved in elevation of endoplasmic reticulum Ca(2+) storage reduction in response to CHRM1. 

Protein Sequence MAAAPVAAGSGAGRGRRSAATVAAWGGWGGRPRPGNILLQLRQGQLTGRGLVRAVQFTETFLTERDKQSK...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
70Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DKQSKWSGI
HHHHHHCCH
42.77Phosphositeplus
Link-
157Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GQKLKISDE
CCEEEEHHH
47.39Phosphositeplus
Link-
218Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ILGVKKEMI
HHHHHHHHH
41.01Phosphositeplus
Link-
269Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TLLAKNAQQ
HHHHCCHHH
53.43Phosphositeplus
Link-
275Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AQQKKSLSL
HHHHCCCCC
52.90Phosphositeplus
Link-
303Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ERLCKLATR
HHHHHHHHH
45.83Phosphositeplus
Link-
415Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IAEFKLIPG
HHHHHHCCC
36.69Phosphositeplus
Link-
472Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HHENKYLLL
HCCCCEEEE
34.00Phosphositeplus
Link-
523Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LQVMKKEPA
HHHHHCCCC
55.94Phosphositeplus
Link-
557Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MFLLKRGLL
HHHHHHHHH
46.71Phosphositeplus
Link-
598Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VDAFKRFNK
HHHHHHHHH
58.77Phosphositeplus
Link-
602Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KRFNKYINT
HHHHHHHCC
44.81Phosphositeplus
Link-
720Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EHSKKYPGF
HHCCCCCCH
60.74Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
NEMO_HUMANin vitroHPRD:09238HPRD14585990
TNR1A_HUMANin vivoHPRD:09238HPRD14585990
IKKA_HUMANin vitro
in vivo
HPRD:09238HPRD14585990
TRADD_HUMANin vitro
in vivo
HPRD:09238HPRD14585990
TRAF2_HUMANin vitro
in vivo
HPRD:09238HPRD14585990
16876162
IKKB_HUMANin vitroHPRD:09238HPRD14585990
RIPK1_HUMANin vitro
in vivo
HPRD:09238HPRD14585990
TNR1A_HUMANENSP00000252015STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures