Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Triosephosphate isomerase  

UniProtKB / Swiss-Prot ID :  TPIS_RABIT

Gene Name (Synonyms) : 
TPI1  

Species :  Oryctolagus cuniculus (Rabbit). 

Subcellular Localization :   

Protein Function :   

Protein Sequence APSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVT...
Predicted Secondary Structure CCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCEEEEECCHHHHHHHHHHHCCCCEEEEEECCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
15Deamidated asparagine.NWKMNGRKK
ECCCCCCHH
43.31UniProtKB
Link
71Deamidated asparagine.YKVTNGAFT
CCCCCCCCC
42.66UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Deamidation
ReferencePubMed
"Terminal marking of triosephosphate isomerase: consequences ofdeamidation.";
Sun A.-Q., Yueksel U., Gracy R.W.;
Arch. Biochem. Biophys. 322:361-368(1995).
Cited for: PARTIAL PROTEIN SEQUENCE, AND DEAMIDATION AT ASN-15 AND ASN-71.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures