Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Trafficking protein particle complex subunit 3  

UniProtKB / Swiss-Prot ID :  TPPC3_HUMAN

Gene Name (Synonyms) : 
TRAPPC3, BET3 CDABP0066  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Golgi apparatus, cis-Golgi network (By similarity). Endoplasmic reticulum (By similarity). 

Protein Function :  May play a role in vesicular transport from endoplasmic reticulum to Golgi. 

Protein Sequence MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHD...
Predicted Secondary Structure CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
42Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EDVNKQLDK
HHHHHHHHH
52.68Phosphositeplus
Link
46Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KQLDKMGFN
HHHHHHHHH
49.90Phosphositeplus
Link
68S-palmitoyl cysteine.NVGRCHDFR
CCCCHHHHH
2.72UniProtKB
Link
156Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QDTLKGDGV
HHHCCCCCE
57.98Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
TPC6A_HUMANphysical interactionEBI-753526
intact16189514
TPC2L_HUMANphysical interactionEBI-755932
intact16189514
TPC6A_HUMANyeast 2-hybridHPRD:11644HPRD16189514
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Palmitoylation
ReferencePubMed
"Structure of palmitoylated BET3: insights into TRAPP complex assemblyand membrane localization.";
Turnbull A.P., Kummel D., Prinz B., Holz C., Schultchen J., Lang C.,Niesen F.H., Hofmann K.P., Delbruck H., Behlke J., Muller E.C.,Jarosch E., Sommer T., Heinemann U.;
EMBO J. 24:875-884(2005).
Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 2-180, SUBUNIT, MUTAGENESISOF CYS-68, AND PALMITOYLATION AT CYS-68.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures