Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Lactotransferrin  

UniProtKB / Swiss-Prot ID :  TRFL_BOVIN

Gene Name (Synonyms) : 
LTF  

Species :  Bos taurus (Bovine). 

Subcellular Localization :  Secreted. 

Protein Function :  Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. Lactotransferrin has antimicrobial activity. The most effective inhibitory activity was seen against E.coli and P.aeruginosa. Lactoferricin B is an antimicrobial peptide. Inhibits the growth of Gram-negative and Gram-positive bacteria. The lactotransferrin transferrin-like domain 1 functions as a serine protease of the peptidase S60 family that cuts arginine rich regions. This function contributes to the antimicrobial activity. 

Protein Sequence MKLFVPALLSLGALGLCLAAPRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRAFALECIRAIAE...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHCCCCCCEEEEEECHHHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
252N-linked (GlcNAc...)./FTId=CAR_000186.LLCLNNSRA
EECCCCCCC
43.35UniProtKB
Link
387N-linked (GlcNAc...).QSGQNVTCA
HHCCCEEEE
34.29UniProtKB
Link
495N-linked (GlcNAc...).GLIVNQTGS
EEEEEECCC
27.05UniProtKB
Link
564N-linked (GlcNAc...).AFVKNDTVW
EEECCEEEE
44.90UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures