Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Melanotransferrin  

UniProtKB / Swiss-Prot ID :  TRFM_HUMAN

Gene Name (Synonyms) : 
MFI2, MAP97  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Isoform 1: Cell membrane; Lipid-anchor, GPI- anchor. 

Protein Function :  Involved in iron cellular uptake. Seems to be internalized and then recycled back to the cell membrane. Binds a single atom of iron per subunit. Could also bind zinc. 

Protein Sequence MRGPSGALWLLLALRTVLGGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQ...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHCC...
Protein Variant
LocationDescription
294R -> W (in dbSNP:rs2276790). VAR_020413
559A -> T (in dbSNP:rs17129219). VAR_057304
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PDIA3_HUMANdisulfide bond)MINT-4301273MINT17170699
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures